Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 1524644..1525298 | Replicon | chromosome |
Accession | NZ_LR134334 | ||
Organism | Pseudomonas chlororaphis strain NCTC7357 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL332_RS06395 | Protein ID | WP_124324922.1 |
Coordinates | 1524644..1524994 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL332_RS06400 | Protein ID | WP_124324923.1 |
Coordinates | 1524984..1525298 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL332_RS06385 | 1521395..1522927 | + | 1533 | WP_053279911.1 | NADH-quinone oxidoreductase subunit M | - |
EL332_RS06390 | 1522935..1524398 | + | 1464 | WP_009049791.1 | NADH-quinone oxidoreductase subunit NuoN | - |
EL332_RS06395 | 1524644..1524994 | + | 351 | WP_124324922.1 | toxin | Toxin |
EL332_RS06400 | 1524984..1525298 | + | 315 | WP_124324923.1 | transcriptional regulator | Antitoxin |
EL332_RS06405 | 1525476..1527218 | - | 1743 | WP_025804713.1 | ABC transporter substrate-binding protein | - |
EL332_RS06410 | 1527269..1527541 | - | 273 | WP_025804714.1 | DUF2160 domain-containing protein | - |
EL332_RS06415 | 1527552..1528352 | - | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
EL332_RS06420 | 1528364..1529230 | - | 867 | WP_124324924.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13791.76 Da Isoelectric Point: 9.4187
>T287717 WP_124324922.1 NZ_LR134334:1524644-1524994 [Pseudomonas chlororaphis]
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGVGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTSHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGVGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTSHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|