Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 2720089..2721332 | Replicon | chromosome |
Accession | NZ_LR134332 | ||
Organism | Legionella pneumophila strain NCTC11193 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | Q5ZSZ6 |
Locus tag | EL176_RS12350 | Protein ID | WP_010948074.1 |
Coordinates | 2720394..2721332 (+) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | Q5ZSZ7 |
Locus tag | EL176_RS12345 | Protein ID | WP_010948073.1 |
Coordinates | 2720089..2720397 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL176_RS12320 | 2715525..2715890 | + | 366 | WP_010948069.1 | BRCT domain-containing protein | - |
EL176_RS12325 | 2716247..2716612 | - | 366 | WP_010948070.1 | TraK family protein | - |
EL176_RS15790 | 2716797..2716937 | - | 141 | WP_153802426.1 | hypothetical protein | - |
EL176_RS12330 | 2716940..2718691 | - | 1752 | WP_010948071.1 | DUF927 domain-containing protein | - |
EL176_RS12335 | 2718757..2719032 | - | 276 | WP_010948072.1 | helix-turn-helix domain-containing protein | - |
EL176_RS12340 | 2719865..2720092 | + | 228 | WP_006870829.1 | helix-turn-helix transcriptional regulator | - |
EL176_RS12345 | 2720089..2720397 | + | 309 | WP_010948073.1 | HipA N-terminal domain-containing protein | Antitoxin |
EL176_RS12350 | 2720394..2721332 | + | 939 | WP_010948074.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
EL176_RS12360 | 2721875..2722489 | + | 615 | WP_010948075.1 | hypothetical protein | - |
EL176_RS12365 | 2722645..2722851 | - | 207 | WP_015444115.1 | hypothetical protein | - |
EL176_RS12370 | 2723188..2724456 | + | 1269 | WP_010948076.1 | lpg2372 family Dot/Icm T4SS effector | - |
EL176_RS12375 | 2724672..2725197 | - | 526 | Protein_2379 | hypothetical protein | - |
EL176_RS12380 | 2725197..2725862 | - | 666 | WP_015444114.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36077.81 Da Isoelectric Point: 8.6882
>T287708 WP_010948074.1 NZ_LR134332:2720394-2721332 [Legionella pneumophila]
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|