Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 2782404..2782926 | Replicon | chromosome |
Accession | NZ_LR134331 | ||
Organism | Lacticaseibacillus rhamnosus strain NCTC13764 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | C2JUK2 |
Locus tag | EL173_RS14055 | Protein ID | WP_005687756.1 |
Coordinates | 2782666..2782926 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C2JUK3 |
Locus tag | EL173_RS14050 | Protein ID | WP_005687754.1 |
Coordinates | 2782404..2782673 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL173_RS14035 | 2777891..2779759 | - | 1869 | WP_014571687.1 | HTH domain-containing protein | - |
EL173_RS14040 | 2779786..2780586 | - | 801 | WP_005690776.1 | SDR family oxidoreductase | - |
EL173_RS14045 | 2781192..2782208 | - | 1017 | WP_019728331.1 | IS30 family transposase | - |
EL173_RS14050 | 2782404..2782673 | + | 270 | WP_005687754.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
EL173_RS14055 | 2782666..2782926 | + | 261 | WP_005687756.1 | Txe/YoeB family addiction module toxin | Toxin |
EL173_RS14060 | 2783137..2783865 | - | 729 | WP_014571689.1 | L-ribulose-5-phosphate 4-epimerase | - |
EL173_RS14065 | 2784062..2784883 | + | 822 | WP_005690770.1 | Cof-type HAD-IIB family hydrolase | - |
EL173_RS14070 | 2784950..2785837 | - | 888 | WP_014571690.1 | L-ribulose-5-phosphate 3-epimerase | - |
EL173_RS14075 | 2786022..2786801 | - | 780 | WP_005690765.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
EL173_RS14080 | 2786869..2787510 | - | 642 | WP_005690763.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10485.91 Da Isoelectric Point: 9.6577
>T287707 WP_005687756.1 NZ_LR134331:2782666-2782926 [Lacticaseibacillus rhamnosus]
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N526 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N594 |