Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 717423..718018 | Replicon | chromosome |
Accession | NZ_LR134330 | ||
Organism | Pseudomonas aeruginosa strain NCTC13715 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9E8L6K5 |
Locus tag | EL342_RS03420 | Protein ID | WP_071534386.1 |
Coordinates | 717740..718018 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL342_RS03415 | Protein ID | WP_003133769.1 |
Coordinates | 717423..717728 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL342_RS03380 | 712564..713412 | + | 849 | WP_009878189.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
EL342_RS03390 | 713579..714520 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
EL342_RS03395 | 714637..715251 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
EL342_RS03400 | 715293..715877 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
EL342_RS03405 | 715918..717018 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
EL342_RS03415 | 717423..717728 | - | 306 | WP_003133769.1 | HigA family addiction module antidote protein | Antitoxin |
EL342_RS03420 | 717740..718018 | - | 279 | WP_071534386.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL342_RS03430 | 718341..720569 | + | 2229 | WP_033938414.1 | TonB-dependent receptor | - |
EL342_RS03435 | 720639..721286 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
EL342_RS03440 | 721348..722586 | - | 1239 | WP_033938412.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10698.23 Da Isoelectric Point: 7.9184
>T287698 WP_071534386.1 NZ_LR134330:c718018-717740 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMHHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMHHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|