Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 4001963..4002576 | Replicon | chromosome |
Accession | NZ_LR134329 | ||
Organism | Bordetella parapertussis strain NCTC10524 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0MEM3 |
Locus tag | EL261_RS19050 | Protein ID | WP_003811545.1 |
Coordinates | 4001963..4002274 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL261_RS19055 | Protein ID | WP_003811547.1 |
Coordinates | 4002277..4002576 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL261_RS19025 | 3997115..3997669 | - | 555 | Protein_3726 | LamB/YcsF family protein | - |
EL261_RS19030 | 3997666..3999060 | - | 1395 | WP_003811536.1 | arylsulfatase | - |
EL261_RS19035 | 3999075..4000037 | - | 963 | WP_041937418.1 | tripartite tricarboxylate transporter substrate binding protein | - |
EL261_RS19040 | 4000154..4001107 | + | 954 | WP_041937234.1 | LysR family transcriptional regulator | - |
EL261_RS19045 | 4001226..4001849 | + | 624 | WP_003811542.1 | glutathione S-transferase family protein | - |
EL261_RS19050 | 4001963..4002274 | + | 312 | WP_003811545.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL261_RS19055 | 4002277..4002576 | + | 300 | WP_003811547.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL261_RS19060 | 4002590..4005181 | - | 2592 | WP_065956700.1 | autotransporter domain-containing protein | - |
EL261_RS19065 | 4005311..4005985 | + | 675 | WP_010928712.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11810.72 Da Isoelectric Point: 8.8245
>T287696 WP_003811545.1 NZ_LR134329:4001963-4002274 [Bordetella parapertussis]
MEFIETPIFTQLITALLSDEEYSRLQQLLIDNPERGDLLRGGGGIRKMRYGRQGTGKRGGIRVIYYWISQDCQIYMLAAY
AKSKKINLTPDEIAALRELVKEL
MEFIETPIFTQLITALLSDEEYSRLQQLLIDNPERGDLLRGGGGIRKMRYGRQGTGKRGGIRVIYYWISQDCQIYMLAAY
AKSKKINLTPDEIAALRELVKEL
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|