Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3666711..3667411 | Replicon | chromosome |
Accession | NZ_LR134326 | ||
Organism | Bordetella bronchiseptica strain NCTC10543 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | A0A0H3LPJ8 |
Locus tag | EL288_RS17085 | Protein ID | WP_003809515.1 |
Coordinates | 3667115..3667411 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q7VY40 |
Locus tag | EL288_RS17080 | Protein ID | WP_003809516.1 |
Coordinates | 3666711..3667112 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL288_RS17050 | 3661896..3662918 | - | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
EL288_RS17055 | 3663055..3664092 | - | 1038 | WP_003809529.1 | threonylcarbamoyl-AMP synthase | - |
EL288_RS17060 | 3664112..3665302 | - | 1191 | WP_003809527.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
EL288_RS17065 | 3665305..3665820 | - | 516 | WP_033454360.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
EL288_RS17070 | 3665968..3666447 | - | 480 | WP_003809523.1 | disulfide bond formation protein B | - |
EL288_RS17075 | 3666455..3666691 | - | 237 | WP_003809519.1 | hypothetical protein | - |
EL288_RS17080 | 3666711..3667112 | - | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EL288_RS17085 | 3667115..3667411 | - | 297 | WP_003809515.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
EL288_RS17090 | 3667694..3668575 | - | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
EL288_RS17095 | 3668801..3669247 | + | 447 | WP_003809511.1 | GFA family protein | - |
EL288_RS17100 | 3669333..3670397 | - | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
EL288_RS17105 | 3670573..3671115 | - | 543 | WP_003809508.1 | MOSC domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10608.50 Da Isoelectric Point: 7.9291
>T287690 WP_003809515.1 NZ_LR134326:c3667411-3667115 [Bordetella bronchiseptica]
MEKGTPHCKLPALKALVHAGQVRATYSALSGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAV
YLKLTVLDGVLIVSFKEL
MEKGTPHCKLPALKALVHAGQVRATYSALSGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAV
YLKLTVLDGVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT287690 WP_003809516.1 NZ_LR134326:c3667112-3666711 [Bordetella bronchiseptica]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3LPJ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3LKS6 |