Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2524384..2524997 | Replicon | chromosome |
Accession | NZ_LR134326 | ||
Organism | Bordetella bronchiseptica strain NCTC10543 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0MEM3 |
Locus tag | EL288_RS11790 | Protein ID | WP_003811545.1 |
Coordinates | 2524686..2524997 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL288_RS11785 | Protein ID | WP_003811547.1 |
Coordinates | 2524384..2524683 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL288_RS11775 | 2520492..2521166 | - | 675 | WP_003811550.1 | response regulator transcription factor | - |
EL288_RS11780 | 2521296..2524370 | + | 3075 | WP_126621938.1 | autotransporter SphB2 | - |
EL288_RS11785 | 2524384..2524683 | - | 300 | WP_003811547.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL288_RS11790 | 2524686..2524997 | - | 312 | WP_003811545.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL288_RS11795 | 2525111..2525734 | - | 624 | WP_003811542.1 | glutathione S-transferase family protein | - |
EL288_RS11800 | 2525853..2526806 | - | 954 | WP_033451213.1 | LysR family transcriptional regulator | - |
EL288_RS11805 | 2526924..2527886 | + | 963 | WP_003811538.1 | tripartite tricarboxylate transporter substrate binding protein | - |
EL288_RS11810 | 2527901..2529295 | + | 1395 | WP_003811536.1 | arylsulfatase | - |
EL288_RS11815 | 2529292..2529879 | + | 588 | WP_003811534.1 | LamB/YcsF family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11810.72 Da Isoelectric Point: 8.8245
>T287689 WP_003811545.1 NZ_LR134326:c2524997-2524686 [Bordetella bronchiseptica]
MEFIETPIFTQLITALLSDEEYSRLQQLLIDNPERGDLLRGGGGIRKMRYGRQGTGKRGGIRVIYYWISQDCQIYMLAAY
AKSKKINLTPDEIAALRELVKEL
MEFIETPIFTQLITALLSDEEYSRLQQLLIDNPERGDLLRGGGGIRKMRYGRQGTGKRGGIRVIYYWISQDCQIYMLAAY
AKSKKINLTPDEIAALRELVKEL
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|