Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 3735312..3735966 | Replicon | chromosome |
| Accession | NZ_LR134318 | ||
| Organism | Pseudomonas fluorescens strain NCTC9428 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL257_RS16850 | Protein ID | WP_126364509.1 |
| Coordinates | 3735312..3735662 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL257_RS16855 | Protein ID | WP_126364511.1 |
| Coordinates | 3735652..3735966 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL257_RS16840 | 3731994..3733526 | + | 1533 | WP_016775285.1 | NADH-quinone oxidoreductase subunit M | - |
| EL257_RS16845 | 3733534..3734997 | + | 1464 | WP_024013420.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| EL257_RS16850 | 3735312..3735662 | + | 351 | WP_126364509.1 | toxin | Toxin |
| EL257_RS16855 | 3735652..3735966 | + | 315 | WP_126364511.1 | transcriptional regulator | Antitoxin |
| EL257_RS16860 | 3736082..3737824 | - | 1743 | WP_126364513.1 | ABC transporter substrate-binding protein | - |
| EL257_RS16865 | 3737872..3738144 | - | 273 | WP_126364515.1 | DUF2160 domain-containing protein | - |
| EL257_RS16870 | 3738155..3738955 | - | 801 | WP_041477086.1 | carbohydrate ABC transporter permease | - |
| EL257_RS16875 | 3738965..3739831 | - | 867 | WP_007912484.1 | sugar ABC transporter permease | - |
| EL257_RS16880 | 3739828..3740937 | - | 1110 | WP_126364517.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13930.74 Da Isoelectric Point: 6.4721
>T287662 WP_126364509.1 NZ_LR134318:3735312-3735662 [Pseudomonas fluorescens]
MDALFIELPAFQKHRDDYLDEDLFLSFQLELLKNPEAGDLIEETGGLRKIRFCDQRRGKGKRSGLRVIYYWWSGFDQFWL
FTVYSKSDQNDLTPAQKKLFRQTLDRELNTRTHYET
MDALFIELPAFQKHRDDYLDEDLFLSFQLELLKNPEAGDLIEETGGLRKIRFCDQRRGKGKRSGLRVIYYWWSGFDQFWL
FTVYSKSDQNDLTPAQKKLFRQTLDRELNTRTHYET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|