Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4437612..4438214 | Replicon | chromosome |
Accession | NZ_LR134315 | ||
Organism | Escherichia coli strain NCTC9064 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | EL184_RS21575 | Protein ID | WP_000897305.1 |
Coordinates | 4437903..4438214 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL184_RS21570 | Protein ID | WP_000356397.1 |
Coordinates | 4437612..4437902 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL184_RS21545 | 4433557..4434459 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
EL184_RS21550 | 4434456..4435091 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
EL184_RS21555 | 4435088..4436017 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
EL184_RS21560 | 4436347..4436589 | - | 243 | WP_001086388.1 | hypothetical protein | - |
EL184_RS21565 | 4436808..4437026 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
EL184_RS21570 | 4437612..4437902 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL184_RS21575 | 4437903..4438214 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
EL184_RS21580 | 4438443..4439351 | + | 909 | WP_044722469.1 | alpha/beta hydrolase | - |
EL184_RS21585 | 4439519..4441333 | - | 1815 | WP_096835633.1 | hypothetical protein | - |
EL184_RS21590 | 4441748..4442689 | - | 942 | WP_157912355.1 | fatty acid biosynthesis protein FabY | - |
EL184_RS21595 | 4442734..4443171 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T287656 WP_000897305.1 NZ_LR134315:c4438214-4437903 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|