Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1043819..1044546 | Replicon | chromosome |
Accession | NZ_LR134315 | ||
Organism | Escherichia coli strain NCTC9064 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | EL184_RS05080 | Protein ID | WP_000547564.1 |
Coordinates | 1043819..1044130 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL184_RS05085 | Protein ID | WP_000126294.1 |
Coordinates | 1044127..1044546 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL184_RS05050 | 1038961..1040670 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
EL184_RS05055 | 1040680..1041222 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
EL184_RS05060 | 1041222..1041989 | + | 768 | WP_000067401.1 | formate hydrogenlyase subunit HycG | - |
EL184_RS05065 | 1041986..1042396 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
EL184_RS05070 | 1042389..1042859 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
EL184_RS05075 | 1042884..1043645 | + | 762 | WP_001026445.1 | hypothetical protein | - |
EL184_RS05080 | 1043819..1044130 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
EL184_RS05085 | 1044127..1044546 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL184_RS05090 | 1044661..1046085 | - | 1425 | WP_000110319.1 | 6-phospho-beta-glucosidase AscB | - |
EL184_RS05095 | 1046094..1047551 | - | 1458 | WP_001107862.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
EL184_RS05100 | 1047811..1048821 | + | 1011 | WP_001343660.1 | DNA-binding transcriptional regulator AscG | - |
EL184_RS05105 | 1048970..1049497 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T287640 WP_000547564.1 NZ_LR134315:1043819-1044130 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT287640 WP_000126294.1 NZ_LR134315:1044127-1044546 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|