Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 636845..637572 | Replicon | chromosome |
Accession | NZ_LR134315 | ||
Organism | Escherichia coli strain NCTC9064 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | EL184_RS03135 | Protein ID | WP_000550189.1 |
Coordinates | 636845..637159 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL184_RS03140 | Protein ID | WP_000560266.1 |
Coordinates | 637156..637572 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL184_RS03115 | 633011..633997 | - | 987 | WP_001297165.1 | Gfo/Idh/MocA family oxidoreductase | - |
EL184_RS03120 | 634076..634759 | - | 684 | WP_001183053.1 | vancomycin high temperature exclusion protein | - |
EL184_RS03125 | 634836..635339 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
EL184_RS03130 | 635424..636560 | + | 1137 | WP_000018681.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
EL184_RS03135 | 636845..637159 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
EL184_RS03140 | 637156..637572 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
EL184_RS03145 | 637617..639635 | - | 2019 | WP_000121451.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
EL184_RS03150 | 640061..642412 | - | 2352 | WP_000695481.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T287636 WP_000550189.1 NZ_LR134315:636845-637159 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT287636 WP_000560266.1 NZ_LR134315:637156-637572 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|