Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2624576..2624912 | Replicon | chromosome |
| Accession | NZ_LR134312 | ||
| Organism | Enterococcus faecalis strain NCTC8745 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | E2Z0W4 |
| Locus tag | EL135_RS13080 | Protein ID | WP_002381035.1 |
| Coordinates | 2624576..2624719 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2624863..2624912 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL135_RS13055 | 2620675..2621304 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
| EL135_RS13065 | 2621997..2623613 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
| EL135_RS13070 | 2623943..2624086 | + | 144 | WP_002392818.1 | putative holin-like toxin | - |
| EL135_RS13075 | 2624205..2624345 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| EL135_RS13080 | 2624576..2624719 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
| - | 2624863..2624912 | + | 50 | - | - | Antitoxin |
| EL135_RS13085 | 2624914..2627910 | - | 2997 | WP_002385134.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T287629 WP_002381035.1 NZ_LR134312:2624576-2624719 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT287629 NZ_LR134312:2624863-2624912 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|