Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4650799..4651401 | Replicon | chromosome |
Accession | NZ_LR134311 | ||
Organism | Escherichia coli strain NCTC9113 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | EL186_RS22475 | Protein ID | WP_000897305.1 |
Coordinates | 4651090..4651401 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL186_RS22470 | Protein ID | WP_000356397.1 |
Coordinates | 4650799..4651089 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL186_RS22445 | 4646725..4647627 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
EL186_RS22450 | 4647624..4648259 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
EL186_RS22455 | 4648256..4649185 | + | 930 | WP_000027706.1 | formate dehydrogenase accessory protein FdhE | - |
EL186_RS22460 | 4649515..4649757 | - | 243 | WP_001087409.1 | hypothetical protein | - |
EL186_RS22465 | 4649976..4650194 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
EL186_RS22470 | 4650799..4651089 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL186_RS22475 | 4651090..4651401 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
EL186_RS22480 | 4651630..4652538 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
EL186_RS22485 | 4652602..4653543 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
EL186_RS22490 | 4653588..4654025 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EL186_RS22495 | 4654022..4654894 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
EL186_RS22500 | 4654888..4655487 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T287610 WP_000897305.1 NZ_LR134311:c4651401-4651090 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|