Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5801969..5802564 | Replicon | chromosome |
| Accession | NZ_LR134309 | ||
| Organism | Pseudomonas aeruginosa strain NCTC12903 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | EL344_RS28180 | Protein ID | WP_003117425.1 |
| Coordinates | 5802286..5802564 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL344_RS28175 | Protein ID | WP_003099268.1 |
| Coordinates | 5801969..5802274 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL344_RS28140 | 5797422..5797712 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
| EL344_RS28150 | 5797924..5798196 | - | 273 | WP_003115921.1 | hypothetical protein | - |
| EL344_RS28155 | 5798306..5798572 | + | 267 | WP_016852153.1 | hypothetical protein | - |
| EL344_RS28160 | 5798695..5799540 | + | 846 | WP_196645791.1 | helix-turn-helix domain-containing protein | - |
| EL344_RS28165 | 5799515..5801053 | + | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
| EL344_RS28170 | 5801065..5801592 | - | 528 | WP_071535723.1 | AAA family ATPase | - |
| EL344_RS28175 | 5801969..5802274 | - | 306 | WP_003099268.1 | HigA family addiction module antidote protein | Antitoxin |
| EL344_RS28180 | 5802286..5802564 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL344_RS28190 | 5802893..5805121 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| EL344_RS28195 | 5805191..5805838 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| EL344_RS28200 | 5805900..5807138 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T287590 WP_003117425.1 NZ_LR134309:c5802564-5802286 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|