Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1217072..1217766 | Replicon | chromosome |
Accession | NZ_LR134306 | ||
Organism | Yersinia pseudotuberculosis strain NCTC3571 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | A0A0E1NW62 |
Locus tag | EL172_RS05415 | Protein ID | WP_002214787.1 |
Coordinates | 1217072..1217368 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q666X1 |
Locus tag | EL172_RS05420 | Protein ID | WP_002209924.1 |
Coordinates | 1217368..1217766 (+) | Length | 133 a.a. |
Genomic Context
Location: 1212196..1213713 (1518 bp)
Type: Others
Protein ID: WP_002209930.1
Type: Others
Protein ID: WP_002209930.1
Location: 1214146..1215360 (1215 bp)
Type: Others
Protein ID: Protein_1000
Type: Others
Protein ID: Protein_1000
Location: 1216223..1216483 (261 bp)
Type: Others
Protein ID: WP_002214785.1
Type: Others
Protein ID: WP_002214785.1
Location: 1216546..1216908 (363 bp)
Type: Others
Protein ID: WP_002209925.1
Type: Others
Protein ID: WP_002209925.1
Location: 1217072..1217368 (297 bp)
Type: Toxin
Protein ID: WP_002214787.1
Type: Toxin
Protein ID: WP_002214787.1
Location: 1217368..1217766 (399 bp)
Type: Antitoxin
Protein ID: WP_002209924.1
Type: Antitoxin
Protein ID: WP_002209924.1
Location: 1220757..1221083 (327 bp)
Type: Others
Protein ID: WP_002209922.1
Type: Others
Protein ID: WP_002209922.1
Location: 1221076..1221228 (153 bp)
Type: Others
Protein ID: WP_002209921.1
Type: Others
Protein ID: WP_002209921.1
Location: 1215416..1215625 (210 bp)
Type: Others
Protein ID: WP_050320983.1
Type: Others
Protein ID: WP_050320983.1
Location: 1218166..1220457 (2292 bp)
Type: Others
Protein ID: WP_050320982.1
Type: Others
Protein ID: WP_050320982.1
Location: 1221242..1221442 (201 bp)
Type: Others
Protein ID: WP_002209920.1
Type: Others
Protein ID: WP_002209920.1
Location: 1221624..1221956 (333 bp)
Type: Others
Protein ID: WP_002214791.1
Type: Others
Protein ID: WP_002214791.1
Location: 1221962..1222198 (237 bp)
Type: Others
Protein ID: WP_002214792.1
Type: Others
Protein ID: WP_002214792.1
Location: 1222211..1222576 (366 bp)
Type: Others
Protein ID: WP_002209919.1
Type: Others
Protein ID: WP_002209919.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL172_RS05385 | 1212196..1213713 | + | 1518 | WP_002209930.1 | lysine--tRNA ligase | - |
EL172_RS05395 | 1214146..1215360 | + | 1215 | Protein_1000 | tyrosine-type recombinase/integrase | - |
EL172_RS05400 | 1215416..1215625 | - | 210 | WP_050320983.1 | hypothetical protein | - |
EL172_RS05405 | 1216223..1216483 | + | 261 | WP_002214785.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
EL172_RS05410 | 1216546..1216908 | + | 363 | WP_002209925.1 | helix-turn-helix domain-containing protein | - |
EL172_RS05415 | 1217072..1217368 | + | 297 | WP_002214787.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
EL172_RS05420 | 1217368..1217766 | + | 399 | WP_002209924.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EL172_RS05425 | 1218166..1220457 | - | 2292 | WP_050320982.1 | toprim domain-containing protein | - |
EL172_RS05430 | 1220757..1221083 | + | 327 | WP_002209922.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
EL172_RS23155 | 1221076..1221228 | + | 153 | WP_002209921.1 | hypothetical protein | - |
EL172_RS05435 | 1221242..1221442 | - | 201 | WP_002209920.1 | AlpA family transcriptional regulator | - |
EL172_RS05440 | 1221624..1221956 | - | 333 | WP_002214791.1 | hypothetical protein | - |
EL172_RS05445 | 1221962..1222198 | - | 237 | WP_002214792.1 | hypothetical protein | - |
EL172_RS05450 | 1222211..1222576 | - | 366 | WP_002209919.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11319.12 Da Isoelectric Point: 7.8810
>T287564 WP_002214787.1 NZ_LR134306:1217072-1217368 [Yersinia pseudotuberculosis]
MEKRTPHTRLLKVKELVLKGNIKTTRTARDGAEELGLSFRDMCDAVSELISADFYKSMTTHQDHTIWQDVYRPMLSCGRV
YLKITVIDDVLNVSFKEI
MEKRTPHTRLLKVKELVLKGNIKTTRTARDGAEELGLSFRDMCDAVSELISADFYKSMTTHQDHTIWQDVYRPMLSCGRV
YLKITVIDDVLNVSFKEI
Download Length: 297 bp
Antitoxin
Download Length: 133 a.a. Molecular weight: 14657.17 Da Isoelectric Point: 8.4923
>AT287564 WP_002209924.1 NZ_LR134306:1217368-1217766 [Yersinia pseudotuberculosis]
MMKCPVCGGVELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETVMTEAESDVYAAKTMLLRKMVNTESIAPAYIVQIRK
KLGLNQREASEIFGGGVNAFSRYEKGKALPHPSTIKLLQVLDKHPELLNEIR
MMKCPVCGGVELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETVMTEAESDVYAAKTMLLRKMVNTESIAPAYIVQIRK
KLGLNQREASEIFGGGVNAFSRYEKGKALPHPSTIKLLQVLDKHPELLNEIR
Download Length: 399 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1NW62 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q666X1 |