Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2190455..2190639 | Replicon | chromosome |
| Accession | NZ_LR134305 | ||
| Organism | Staphylococcus aureus strain NCTC1803 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | EL119_RS11570 | Protein ID | WP_000482647.1 |
| Coordinates | 2190532..2190639 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2190455..2190515 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL119_RS11545 | 2185909..2186076 | - | 168 | WP_041204334.1 | hypothetical protein | - |
| EL119_RS11555 | 2186307..2188040 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
| EL119_RS11560 | 2188065..2189828 | - | 1764 | WP_001064817.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2190455..2190515 | + | 61 | - | - | Antitoxin |
| EL119_RS11570 | 2190532..2190639 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| EL119_RS11575 | 2190773..2191159 | - | 387 | WP_000779350.1 | flippase GtxA | - |
| EL119_RS11580 | 2191427..2192569 | + | 1143 | WP_001176868.1 | glycerate kinase | - |
| EL119_RS11585 | 2192629..2193288 | + | 660 | WP_000831299.1 | hypothetical protein | - |
| EL119_RS11590 | 2193474..2194685 | + | 1212 | WP_001191928.1 | multidrug effflux MFS transporter | - |
| EL119_RS11595 | 2194808..2195281 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T287561 WP_000482647.1 NZ_LR134305:c2190639-2190532 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT287561 NZ_LR134305:2190455-2190515 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|