Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
| Location | 1898566..1898764 | Replicon | chromosome |
| Accession | NZ_LR134305 | ||
| Organism | Staphylococcus aureus strain NCTC1803 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | EL119_RS10030 | Protein ID | WP_001802298.1 |
| Coordinates | 1898660..1898764 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1898566..1898604 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL119_RS10010 | 1894675..1895340 | - | 666 | WP_001024100.1 | SDR family oxidoreductase | - |
| EL119_RS10015 | 1895492..1895812 | + | 321 | WP_094754121.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| EL119_RS10020 | 1895814..1896794 | + | 981 | WP_000019740.1 | CDF family zinc efflux transporter CzrB | - |
| EL119_RS10025 | 1897060..1898151 | + | 1092 | WP_000495692.1 | hypothetical protein | - |
| - | 1898566..1898604 | + | 39 | - | - | Antitoxin |
| EL119_RS10030 | 1898660..1898764 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| EL119_RS14605 | 1898925..1899408 | - | 484 | Protein_1852 | recombinase family protein | - |
| EL119_RS10040 | 1899451..1900571 | - | 1121 | Protein_1853 | SAP domain-containing protein | - |
| EL119_RS10045 | 1901620..1902477 | - | 858 | WP_000370943.1 | Cof-type HAD-IIB family hydrolase | - |
| EL119_RS10050 | 1902545..1903327 | - | 783 | WP_000909235.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T287559 WP_001802298.1 NZ_LR134305:c1898764-1898660 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT287559 NZ_LR134305:1898566-1898604 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|