Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1541756..1541936 | Replicon | chromosome |
| Accession | NZ_LR134305 | ||
| Organism | Staphylococcus aureus strain NCTC1803 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EL119_RS07850 | Protein ID | WP_001801861.1 |
| Coordinates | 1541756..1541851 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1541879..1541936 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL119_RS07815 | 1537160..1537786 | + | 627 | WP_126498393.1 | hypothetical protein | - |
| EL119_RS07820 | 1537827..1538168 | + | 342 | WP_000627544.1 | DUF3969 family protein | - |
| EL119_RS07825 | 1538269..1538841 | + | 573 | WP_000414210.1 | hypothetical protein | - |
| EL119_RS07830 | 1539217..1540053 | + | 837 | WP_000190484.1 | ABC transporter ATP-binding protein | - |
| EL119_RS07840 | 1540859..1541305 | - | 447 | WP_000747806.1 | DUF1433 domain-containing protein | - |
| EL119_RS07850 | 1541756..1541851 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1541879..1541936 | - | 58 | - | - | Antitoxin |
| EL119_RS07855 | 1541974..1542075 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| EL119_RS07860 | 1542061..1542240 | - | 180 | Protein_1479 | transposase | - |
| EL119_RS07865 | 1542428..1542802 | - | 375 | WP_000695817.1 | DUF1433 domain-containing protein | - |
| EL119_RS07870 | 1542792..1543172 | - | 381 | WP_001035978.1 | DUF1433 domain-containing protein | - |
| EL119_RS07875 | 1543380..1543820 | - | 441 | WP_000759945.1 | DUF1433 domain-containing protein | - |
| EL119_RS07880 | 1543865..1545478 | + | 1614 | WP_000926709.1 | hypothetical protein | - |
| EL119_RS07885 | 1545493..1545792 | + | 300 | WP_000095391.1 | WXG100 family type VII secretion target | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T287554 WP_001801861.1 NZ_LR134305:1541756-1541851 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT287554 NZ_LR134305:c1541936-1541879 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|