Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | holin-SprF3/- |
| Location | 57001..57519 | Replicon | chromosome |
| Accession | NZ_LR134305 | ||
| Organism | Staphylococcus aureus strain NCTC1803 | ||
Toxin (Protein)
| Gene name | holin | Uniprot ID | - |
| Locus tag | EL119_RS00400 | Protein ID | WP_000448764.1 |
| Coordinates | 57217..57519 (+) | Length | 101 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 57001..57137 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL119_RS00360 | 52095..52385 | + | 291 | WP_000179860.1 | hypothetical protein | - |
| EL119_RS00365 | 52401..54311 | + | 1911 | WP_000429563.1 | hypothetical protein | - |
| EL119_RS00370 | 54311..55777 | + | 1467 | WP_000067157.1 | BppU family phage baseplate upper protein | - |
| EL119_RS00375 | 55777..56166 | + | 390 | WP_001166604.1 | DUF2977 domain-containing protein | - |
| EL119_RS00380 | 56159..56323 | + | 165 | WP_000916020.1 | XkdX family protein | - |
| EL119_RS00385 | 56369..56668 | + | 300 | WP_000466773.1 | DUF2951 family protein | - |
| EL119_RS14640 | 56820..57009 | + | 190 | Protein_75 | putative holin-like toxin | - |
| - | 57001..57137 | - | 137 | NuclAT_0 | - | Antitoxin |
| - | 57001..57137 | - | 137 | NuclAT_0 | - | Antitoxin |
| - | 57001..57137 | - | 137 | NuclAT_0 | - | Antitoxin |
| - | 57001..57137 | - | 137 | NuclAT_0 | - | Antitoxin |
| EL119_RS00395 | 57056..57166 | - | 111 | WP_070003492.1 | hypothetical protein | - |
| EL119_RS00400 | 57217..57519 | + | 303 | WP_000448764.1 | phage holin | Toxin |
| EL119_RS00405 | 57531..58985 | + | 1455 | WP_000930278.1 | N-acetylmuramoyl-L-alanine amidase | - |
| EL119_RS14720 | 59808..59921 | - | 114 | Protein_79 | amidase | - |
| EL119_RS00415 | 60499..60996 | + | 498 | WP_001803960.1 | hypothetical protein | - |
| EL119_RS00425 | 61556..62383 | - | 828 | WP_000136028.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 14062..58985 | 44923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11230.99 Da Isoelectric Point: 9.6587
>T287550 WP_000448764.1 NZ_LR134305:57217-57519 [Staphylococcus aureus]
METKVITRYIVLILALVNQFLANKGISPIPVDEESISSIILTVIALYTAYKDNPTSQEGRWANQKLKKYKAENKYRKATG
QAPIKEVMTPTNMNDTNDLG
METKVITRYIVLILALVNQFLANKGISPIPVDEESISSIILTVIALYTAYKDNPTSQEGRWANQKLKKYKAENKYRKATG
QAPIKEVMTPTNMNDTNDLG
Download Length: 303 bp
Antitoxin
Download Length: 137 bp
>AT287550 NZ_LR134305:c57137-57001 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGACCTCTGTAGTTAAAT
GAATTTATATAATCCTCTAACCATCGTACTCGTCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGACCTCTGTAGTTAAAT
GAATTTATATAATCCTCTAACCATCGTACTCGTCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|