Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 2492936..2493459 | Replicon | chromosome |
Accession | NZ_LR134304 | ||
Organism | Staphylococcus schweitzeri strain NCTC13712 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A2K4AFL7 |
Locus tag | EL116_RS12355 | Protein ID | WP_047549951.1 |
Coordinates | 2492936..2493202 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A2K4AGF2 |
Locus tag | EL116_RS12360 | Protein ID | WP_000587615.1 |
Coordinates | 2493202..2493459 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL116_RS12335 | 2488338..2489525 | - | 1188 | WP_047529796.1 | MFS transporter | - |
EL116_RS12340 | 2489878..2490651 | - | 774 | WP_047426423.1 | iron export ABC transporter permease subunit FetB | - |
EL116_RS12345 | 2490644..2491306 | - | 663 | WP_047549945.1 | ATP-binding cassette domain-containing protein | - |
EL116_RS12350 | 2491547..2492623 | - | 1077 | WP_047549948.1 | M42 family metallopeptidase | - |
EL116_RS12355 | 2492936..2493202 | - | 267 | WP_047549951.1 | Txe/YoeB family addiction module toxin | Toxin |
EL116_RS12360 | 2493202..2493459 | - | 258 | WP_000587615.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL116_RS12365 | 2493816..2494280 | + | 465 | WP_047426431.1 | DUF1307 domain-containing protein | - |
EL116_RS12370 | 2494448..2496025 | - | 1578 | WP_047549954.1 | FMN-binding glutamate synthase family protein | - |
EL116_RS12375 | 2496215..2496964 | + | 750 | WP_047549957.1 | hypothetical protein | - |
EL116_RS12380 | 2497188..2498381 | - | 1194 | WP_006191034.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10647.20 Da Isoelectric Point: 9.7239
>T287549 WP_047549951.1 NZ_LR134304:c2493202-2492936 [Staphylococcus schweitzeri]
MSNYTVKIKNSAKSDLKKIKHSYLKESFLEIVETLKNDPHKITQSFEKLEPKYLERYLRRINYQHRVVYTVDDQNKEVLI
LSAWSHYD
MSNYTVKIKNSAKSDLKKIKHSYLKESFLEIVETLKNDPHKITQSFEKLEPKYLERYLRRINYQHRVVYTVDDQNKEVLI
LSAWSHYD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K4AFL7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K4AGF2 |