Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2463835..2464019 | Replicon | chromosome |
Accession | NZ_LR134304 | ||
Organism | Staphylococcus schweitzeri strain NCTC13712 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2K4AFL5 |
Locus tag | EL116_RS12230 | Protein ID | WP_000482651.1 |
Coordinates | 2463912..2464019 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2463835..2463895 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL116_RS12220 | 2459580..2461313 | - | 1734 | WP_047549901.1 | ABC transporter ATP-binding protein/permease | - |
EL116_RS12225 | 2461338..2463101 | - | 1764 | WP_047529842.1 | ABC transporter ATP-binding protein/permease | - |
- | 2463835..2463895 | + | 61 | - | - | Antitoxin |
EL116_RS12230 | 2463912..2464019 | - | 108 | WP_000482651.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EL116_RS12235 | 2464152..2464538 | - | 387 | WP_047426382.1 | flippase GtxA | - |
EL116_RS12240 | 2464806..2465948 | + | 1143 | WP_047449388.1 | glycerate kinase | - |
EL116_RS12245 | 2466007..2466660 | + | 654 | WP_047549905.1 | membrane protein | - |
EL116_RS12250 | 2466853..2468064 | + | 1212 | WP_047549907.1 | multidrug effflux MFS transporter | - |
EL116_RS12255 | 2468179..2468658 | - | 480 | WP_047549911.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3984.75 Da Isoelectric Point: 11.0582
>T287548 WP_000482651.1 NZ_LR134304:c2464019-2463912 [Staphylococcus schweitzeri]
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT287548 NZ_LR134304:2463835-2463895 [Staphylococcus schweitzeri]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|