Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 2438690..2439207 | Replicon | chromosome |
| Accession | NZ_LR134304 | ||
| Organism | Staphylococcus schweitzeri strain NCTC13712 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | A0A2K4AFN5 |
| Locus tag | EL116_RS12105 | Protein ID | WP_047549868.1 |
| Coordinates | 2438690..2438956 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A2K4AFP1 |
| Locus tag | EL116_RS12110 | Protein ID | WP_047549871.1 |
| Coordinates | 2438956..2439207 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL116_RS12080 | 2434115..2434651 | - | 537 | WP_047549856.1 | GNAT family N-acetyltransferase | - |
| EL116_RS12085 | 2434890..2435714 | - | 825 | WP_000572040.1 | formate/nitrite transporter family protein | - |
| EL116_RS12090 | 2435930..2436115 | - | 186 | WP_047425811.1 | hypothetical protein | - |
| EL116_RS12095 | 2436199..2436666 | - | 468 | WP_047549859.1 | SRPBCC domain-containing protein | - |
| EL116_RS12100 | 2436851..2438398 | - | 1548 | WP_047425807.1 | zinc ABC transporter substrate-binding lipoprotein AdcA | - |
| EL116_RS12105 | 2438690..2438956 | - | 267 | WP_047549868.1 | Txe/YoeB family addiction module toxin | Toxin |
| EL116_RS12110 | 2438956..2439207 | - | 252 | WP_047549871.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| EL116_RS12115 | 2439369..2439470 | - | 102 | Protein_2282 | hypothetical protein | - |
| EL116_RS12120 | 2439477..2440076 | - | 600 | WP_047549875.1 | DsbA family protein | - |
| EL116_RS12125 | 2440096..2440458 | - | 363 | WP_047425801.1 | DUF4467 domain-containing protein | - |
| EL116_RS12130 | 2440712..2441962 | + | 1251 | WP_047549878.1 | aminoacyltransferase | - |
| EL116_RS12135 | 2442057..2442788 | - | 732 | WP_047529873.1 | amino acid ABC transporter ATP-binding protein | - |
| EL116_RS12140 | 2442785..2443504 | - | 720 | WP_047425796.1 | amino acid ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10409.94 Da Isoelectric Point: 10.0573
>T287547 WP_047549868.1 NZ_LR134304:c2438956-2438690 [Staphylococcus schweitzeri]
MTRLNITFSPQAFEDYEYFQQNDKKMVKKINELLKSIDRNGALKGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDGNHIK
IASCKYHY
MTRLNITFSPQAFEDYEYFQQNDKKMVKKINELLKSIDRNGALKGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDGNHIK
IASCKYHY
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K4AFN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K4AFP1 |