Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 793318..793656 | Replicon | chromosome |
Accession | NZ_LR134304 | ||
Organism | Staphylococcus schweitzeri strain NCTC13712 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EL116_RS03845 | Protein ID | WP_011447039.1 |
Coordinates | 793318..793494 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 793482..793656 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL116_RS03825 | 788719..789654 | + | 936 | WP_047427095.1 | thioredoxin-disulfide reductase | - |
EL116_RS03830 | 790002..790913 | + | 912 | WP_031787679.1 | RNase adapter RapZ | - |
EL116_RS03835 | 790910..791911 | + | 1002 | WP_047551142.1 | YvcK family protein | - |
EL116_RS03840 | 792017..792961 | + | 945 | WP_047427100.1 | DNA-binding protein WhiA | - |
EL116_RS03845 | 793318..793494 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 793482..793656 | - | 175 | - | - | Antitoxin |
EL116_RS03855 | 793705..794007 | + | 303 | WP_047530997.1 | phage holin | - |
EL116_RS03860 | 794056..794217 | + | 162 | Protein_717 | N-acetylmuramoyl-L-alanine amidase | - |
EL116_RS03870 | 794587..795174 | + | 588 | WP_001049165.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
EL116_RS03875 | 795353..796987 | + | 1635 | WP_047551149.1 | NAD-dependent malic enzyme | - |
EL116_RS03880 | 797186..798088 | - | 903 | WP_047551151.1 | TIGR01777 family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T287535 WP_011447039.1 NZ_LR134304:793318-793494 [Staphylococcus schweitzeri]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT287535 NZ_LR134304:c793656-793482 [Staphylococcus schweitzeri]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACACGTTACCCTAATGAACCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACACGTTACCCTAATGAACCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|