Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4191613..4192200 | Replicon | chromosome |
Accession | NZ_LR134301 | ||
Organism | Stenotrophomonas maltophilia strain NCTC13014 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | EL200_RS19560 | Protein ID | WP_080354792.1 |
Coordinates | 4191613..4191891 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL200_RS19565 | Protein ID | WP_049443949.1 |
Coordinates | 4191901..4192200 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL200_RS19535 | 4186851..4187948 | + | 1098 | WP_057501087.1 | Fis family transcriptional regulator | - |
EL200_RS19540 | 4187985..4188467 | - | 483 | WP_006471121.1 | YajQ family cyclic di-GMP-binding protein | - |
EL200_RS19545 | 4188587..4189483 | + | 897 | WP_049443945.1 | DMT family transporter | - |
EL200_RS19550 | 4189683..4190690 | + | 1008 | WP_057501086.1 | methionine ABC transporter ATP-binding protein | - |
EL200_RS19555 | 4190687..4191376 | + | 690 | WP_057501085.1 | ABC transporter permease | - |
EL200_RS19560 | 4191613..4191891 | + | 279 | WP_080354792.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL200_RS19565 | 4191901..4192200 | + | 300 | WP_049443949.1 | HigA family addiction module antidote protein | Antitoxin |
EL200_RS19570 | 4192241..4192843 | - | 603 | WP_049443951.1 | lipocalin family protein | - |
EL200_RS19575 | 4192972..4193298 | + | 327 | WP_057501084.1 | hypothetical protein | - |
EL200_RS19580 | 4193368..4195464 | + | 2097 | WP_057501083.1 | prolyl oligopeptidase family protein | - |
EL200_RS19585 | 4195631..4196818 | - | 1188 | WP_057501082.1 | pyridoxal phosphate-dependent aminotransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10685.19 Da Isoelectric Point: 10.3074
>T287519 WP_080354792.1 NZ_LR134301:4191613-4191891 [Stenotrophomonas maltophilia]
MIRSFRCKQTRALFEGTCARAWRPIRRAAERKLQLLDSAQTLAFLRSPPGNRLEALSGDRKGQYSLRINDQWRLCFTWTD
NGADAVEIVDYH
MIRSFRCKQTRALFEGTCARAWRPIRRAAERKLQLLDSAQTLAFLRSPPGNRLEALSGDRKGQYSLRINDQWRLCFTWTD
NGADAVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|