Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 4601789..4602384 | Replicon | chromosome |
Accession | NZ_LR134300 | ||
Organism | Pseudomonas fluorescens strain NCTC10783 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL286_RS21945 | Protein ID | WP_071535843.1 |
Coordinates | 4602106..4602384 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL286_RS21940 | Protein ID | WP_003099268.1 |
Coordinates | 4601789..4602094 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL286_RS21915 | 4597639..4597845 | - | 207 | WP_034076322.1 | AlpA family transcriptional regulator | - |
EL286_RS21920 | 4597900..4599141 | - | 1242 | WP_172616480.1 | hypothetical protein | - |
EL286_RS21925 | 4599245..4600057 | + | 813 | WP_126450760.1 | hypothetical protein | - |
EL286_RS21930 | 4600923..4601120 | + | 198 | WP_023436186.1 | TonB-dependent receptor | - |
EL286_RS21940 | 4601789..4602094 | - | 306 | WP_003099268.1 | HigA family addiction module antidote protein | Antitoxin |
EL286_RS21945 | 4602106..4602384 | - | 279 | WP_071535843.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL286_RS21955 | 4602713..4604941 | + | 2229 | WP_126450762.1 | TonB-dependent receptor | - |
EL286_RS21960 | 4605011..4605658 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
EL286_RS21965 | 4605720..4606958 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10674.25 Da Isoelectric Point: 7.8937
>T287517 WP_071535843.1 NZ_LR134300:c4602384-4602106 [Pseudomonas fluorescens]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|