Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 5156348..5157138 | Replicon | chromosome |
Accession | NZ_LR134299 | ||
Organism | Pseudomonas putida strain NCTC13186 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | Q88NE5 |
Locus tag | EL224_RS24225 | Protein ID | WP_010952397.1 |
Coordinates | 5156671..5157138 (+) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | I7C311 |
Locus tag | EL224_RS24220 | Protein ID | WP_014859917.1 |
Coordinates | 5156348..5156674 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL224_RS24195 | 5151882..5152943 | - | 1062 | WP_049587435.1 | HlyD family secretion protein | - |
EL224_RS24200 | 5152972..5154513 | - | 1542 | WP_010952401.1 | MFS transporter | - |
EL224_RS24205 | 5154630..5155535 | - | 906 | WP_010952400.1 | LysR family transcriptional regulator | - |
EL224_RS24215 | 5155809..5156255 | + | 447 | WP_010952399.1 | universal stress protein | - |
EL224_RS24220 | 5156348..5156674 | + | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
EL224_RS24225 | 5156671..5157138 | + | 468 | WP_010952397.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
EL224_RS24230 | 5157211..5158071 | - | 861 | WP_010952396.1 | HlyD family secretion protein | - |
EL224_RS24235 | 5158082..5158282 | - | 201 | WP_003251718.1 | DUF1656 domain-containing protein | - |
EL224_RS24240 | 5158272..5160449 | - | 2178 | WP_003251716.1 | FUSC family protein | - |
EL224_RS24245 | 5160446..5161975 | - | 1530 | WP_010952395.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17962.34 Da Isoelectric Point: 9.7963
>T287510 WP_010952397.1 NZ_LR134299:5156671-5157138 [Pseudomonas putida]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|