Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1908882..1909582 | Replicon | chromosome |
Accession | NZ_LR134299 | ||
Organism | Pseudomonas putida strain NCTC13186 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | Q88F93 |
Locus tag | EL224_RS08910 | Protein ID | WP_010954960.1 |
Coordinates | 1908882..1909178 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | I7AUJ7 |
Locus tag | EL224_RS08915 | Protein ID | WP_003254235.1 |
Coordinates | 1909181..1909582 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL224_RS08890 | 1904874..1906052 | - | 1179 | WP_010954964.1 | efflux RND transporter periplasmic adaptor subunit | - |
EL224_RS08895 | 1906265..1906741 | + | 477 | WP_010954963.1 | sigma-70 family RNA polymerase sigma factor | - |
EL224_RS08900 | 1906910..1907389 | + | 480 | WP_010954962.1 | hypothetical protein | - |
EL224_RS08905 | 1907462..1908787 | + | 1326 | WP_010954961.1 | MFS transporter | - |
EL224_RS08910 | 1908882..1909178 | + | 297 | WP_010954960.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
EL224_RS08915 | 1909181..1909582 | + | 402 | WP_003254235.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EL224_RS08920 | 1909654..1911336 | - | 1683 | WP_010954959.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
EL224_RS08925 | 1911872..1912621 | + | 750 | WP_003254232.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
EL224_RS08930 | 1912622..1913551 | + | 930 | WP_010954958.1 | FAD-binding protein | - |
EL224_RS08935 | 1913627..1914448 | + | 822 | WP_010954957.1 | transporter substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11133.22 Da Isoelectric Point: 10.2271
>T287505 WP_010954960.1 NZ_LR134299:1908882-1909178 [Pseudomonas putida]
MEKRMPHCPLERVKALAAARRIRPTGAALKGAKALGMDFPGMLEVITSLKRTDFYKSMTSHIDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKEL
MEKRMPHCPLERVKALAAARRIRPTGAALKGAKALGMDFPGMLEVITSLKRTDFYKSMTSHIDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14684.76 Da Isoelectric Point: 4.9531
>AT287505 WP_003254235.1 NZ_LR134299:1909181-1909582 [Pseudomonas putida]
MRCPICGGSELAPDIQGMPYSYKGEMTVIPEVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNANVVDPSFIASIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
MRCPICGGSELAPDIQGMPYSYKGEMTVIPEVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNANVVDPSFIASIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|