Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 1368161..1368762 | Replicon | chromosome |
Accession | NZ_LR134299 | ||
Organism | Pseudomonas putida strain NCTC13186 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2L1IAQ2 |
Locus tag | EL224_RS06360 | Protein ID | WP_049587984.1 |
Coordinates | 1368448..1368762 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2L1IAR7 |
Locus tag | EL224_RS06355 | Protein ID | WP_049587986.1 |
Coordinates | 1368161..1368448 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL224_RS06335 | 1363193..1364038 | + | 846 | WP_003254799.1 | hypothetical protein | - |
EL224_RS06340 | 1364035..1365753 | + | 1719 | WP_010952348.1 | hypothetical protein | - |
EL224_RS06345 | 1365808..1366557 | + | 750 | WP_049587988.1 | hypothetical protein | - |
EL224_RS06350 | 1366629..1367960 | - | 1332 | WP_004576169.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
EL224_RS06355 | 1368161..1368448 | - | 288 | WP_049587986.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL224_RS06360 | 1368448..1368762 | - | 315 | WP_049587984.1 | hypothetical protein | Toxin |
EL224_RS06365 | 1369211..1371121 | + | 1911 | WP_010952353.1 | potassium transporter Kup | - |
EL224_RS06370 | 1371170..1372462 | - | 1293 | WP_010952354.1 | virulence factor family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11784.61 Da Isoelectric Point: 9.9097
>T287504 WP_049587984.1 NZ_LR134299:c1368762-1368448 [Pseudomonas putida]
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L1IAQ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L1IAR7 |