Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 549801..550533 | Replicon | chromosome |
| Accession | NZ_LR134298 | ||
| Organism | Pasteurella multocida subsp. gallicida strain NCTC10204 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2J9QLH7 |
| Locus tag | EL104_RS02665 | Protein ID | WP_005725755.1 |
| Coordinates | 549801..550127 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL104_RS02670 | Protein ID | WP_005757699.1 |
| Coordinates | 550207..550533 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL104_RS02640 | 545118..545804 | + | 687 | WP_005757690.1 | hypothetical protein | - |
| EL104_RS02645 | 545858..547387 | - | 1530 | WP_074866885.1 | YifB family Mg chelatase-like AAA ATPase | - |
| EL104_RS02650 | 547495..548112 | - | 618 | WP_005718080.1 | ribosome biogenesis GTP-binding protein YihA/YsxC | - |
| EL104_RS02655 | 548223..549092 | + | 870 | WP_010907199.1 | VirK/YbjX family protein | - |
| EL104_RS02660 | 549167..549643 | - | 477 | WP_005755093.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| EL104_RS02665 | 549801..550127 | + | 327 | WP_005725755.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL104_RS02670 | 550207..550533 | + | 327 | WP_005757699.1 | HigA family addiction module antidote protein | Antitoxin |
| EL104_RS02675 | 550587..552107 | - | 1521 | WP_059245887.1 | DUF560 domain-containing protein | - |
| EL104_RS02680 | 552166..552768 | - | 603 | WP_005755098.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| EL104_RS02685 | 552855..553805 | - | 951 | WP_126358541.1 | hypothetical protein | - |
| EL104_RS02690 | 554041..555060 | - | 1020 | WP_074866879.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12892.73 Da Isoelectric Point: 9.6705
>T287502 WP_005725755.1 NZ_LR134298:549801-550127 [Pasteurella multocida subsp. gallicida]
MDRVRFNLTEDSFQDKYLYEYFLYGSKHKNIPSDIENTLAHKLDMLDSANTLSDLRSPPGNKLEKLEPKTSGLYSIRVNV
KYRLIFKYKESNFPKITELRLDKHQYRL
MDRVRFNLTEDSFQDKYLYEYFLYGSKHKNIPSDIENTLAHKLDMLDSANTLSDLRSPPGNKLEKLEPKTSGLYSIRVNV
KYRLIFKYKESNFPKITELRLDKHQYRL
Download Length: 327 bp
Antitoxin
Download Length: 109 a.a. Molecular weight: 12377.41 Da Isoelectric Point: 7.2034
>AT287502 WP_005757699.1 NZ_LR134298:550207-550533 [Pasteurella multocida subsp. gallicida]
MSRVQRKPSTVGDILLDEYLVPLNLKIADLATMLDVHRNTASALVNNNTKLSLEMALKLAKLFNTSPEFWLNLQMKLDLW
EIENNARFQESLKKISSIDQHNLLEKIA
MSRVQRKPSTVGDILLDEYLVPLNLKIADLATMLDVHRNTASALVNNNTKLSLEMALKLAKLFNTSPEFWLNLQMKLDLW
EIENNARFQESLKKISSIDQHNLLEKIA
Download Length: 327 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|