Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3636156..3636850 Replicon chromosome
Accession NZ_LR134296
Organism Escherichia coli strain NCTC9041

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag EL151_RS17785 Protein ID WP_001263489.1
Coordinates 3636156..3636554 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag EL151_RS17790 Protein ID WP_000554758.1
Coordinates 3636557..3636850 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- 3631744..3631824 - 81 NuclAT_13 - -
- 3631744..3631824 - 81 NuclAT_13 - -
- 3631744..3631824 - 81 NuclAT_13 - -
- 3631744..3631824 - 81 NuclAT_13 - -
EL151_RS17760 3632420..3632878 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL151_RS17765 3633139..3634596 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
EL151_RS17770 3634653..3635174 - 522 Protein_3432 peptide chain release factor H -
EL151_RS17775 3635170..3635376 - 207 Protein_3433 RtcB family protein -
EL151_RS17780 3635694..3636146 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
EL151_RS17785 3636156..3636554 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL151_RS17790 3636557..3636850 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL151_RS17795 3636902..3637957 - 1056 WP_001226164.1 DNA polymerase IV -
EL151_RS17800 3638028..3638951 - 924 WP_001232546.1 putative lateral flagellar export/assembly protein LafU -
EL151_RS17805 3638954..3639817 - 864 WP_001169518.1 flagellar motor stator protein MotA -
EL151_RS17810 3639830..3640546 - 717 WP_000938723.1 FliA/WhiG family RNA polymerase sigma factor -
EL151_RS17815 3640566..3641033 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T287497 WP_001263489.1 NZ_LR134296:c3636554-3636156 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT287497 WP_000554758.1 NZ_LR134296:c3636850-3636557 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References