Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3675869..3676563 | Replicon | chromosome |
| Accession | NZ_LR134295 | ||
| Organism | Escherichia coli strain NCTC9080 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | EL145_RS17740 | Protein ID | WP_001263493.1 |
| Coordinates | 3675869..3676267 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | EL145_RS17745 | Protein ID | WP_000554757.1 |
| Coordinates | 3676270..3676563 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL145_RS17710 | 3670869..3672113 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3671529..3671609 | - | 81 | NuclAT_10 | - | - |
| - | 3671529..3671609 | - | 81 | NuclAT_10 | - | - |
| - | 3671529..3671609 | - | 81 | NuclAT_10 | - | - |
| - | 3671529..3671609 | - | 81 | NuclAT_10 | - | - |
| EL145_RS17715 | 3672205..3672663 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| EL145_RS17720 | 3672924..3674381 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| EL145_RS17725 | 3674438..3674959 | - | 522 | Protein_3447 | peptide chain release factor H | - |
| EL145_RS17730 | 3674958..3675161 | - | 204 | Protein_3448 | RNA ligase RtcB family protein | - |
| EL145_RS17735 | 3675407..3675859 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| EL145_RS17740 | 3675869..3676267 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| EL145_RS17745 | 3676270..3676563 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| EL145_RS17750 | 3676615..3677670 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| EL145_RS17755 | 3677741..3678526 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| EL145_RS17760 | 3678498..3680209 | + | 1712 | Protein_3454 | flagellar biosynthesis protein FlhA | - |
| EL145_RS17765 | 3680433..3680930 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE / gmhA/lpcA | 3630236..3691148 | 60912 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T287479 WP_001263493.1 NZ_LR134295:c3676267-3675869 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|