Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3675869..3676563 Replicon chromosome
Accession NZ_LR134295
Organism Escherichia coli strain NCTC9080

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag EL145_RS17740 Protein ID WP_001263493.1
Coordinates 3675869..3676267 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag EL145_RS17745 Protein ID WP_000554757.1
Coordinates 3676270..3676563 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL145_RS17710 3670869..3672113 - 1245 WP_000189541.1 esterase FrsA -
- 3671529..3671609 - 81 NuclAT_10 - -
- 3671529..3671609 - 81 NuclAT_10 - -
- 3671529..3671609 - 81 NuclAT_10 - -
- 3671529..3671609 - 81 NuclAT_10 - -
EL145_RS17715 3672205..3672663 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL145_RS17720 3672924..3674381 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
EL145_RS17725 3674438..3674959 - 522 Protein_3447 peptide chain release factor H -
EL145_RS17730 3674958..3675161 - 204 Protein_3448 RNA ligase RtcB family protein -
EL145_RS17735 3675407..3675859 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
EL145_RS17740 3675869..3676267 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL145_RS17745 3676270..3676563 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL145_RS17750 3676615..3677670 - 1056 WP_001226164.1 DNA polymerase IV -
EL145_RS17755 3677741..3678526 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
EL145_RS17760 3678498..3680209 + 1712 Protein_3454 flagellar biosynthesis protein FlhA -
EL145_RS17765 3680433..3680930 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE / gmhA/lpcA 3630236..3691148 60912


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T287479 WP_001263493.1 NZ_LR134295:c3676267-3675869 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT287479 WP_000554757.1 NZ_LR134295:c3676563-3676270 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References