Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2415268..2415906 | Replicon | chromosome |
Accession | NZ_LR134295 | ||
Organism | Escherichia coli strain NCTC9080 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | EL145_RS11545 | Protein ID | WP_000813794.1 |
Coordinates | 2415730..2415906 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL145_RS11540 | Protein ID | WP_001270286.1 |
Coordinates | 2415268..2415684 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL145_RS11520 | 2410420..2411361 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
EL145_RS11525 | 2411362..2412375 | - | 1014 | WP_000220393.1 | ABC transporter ATP-binding protein | - |
EL145_RS11530 | 2412393..2413538 | - | 1146 | WP_000047429.1 | ABC transporter substrate-binding protein | - |
EL145_RS11535 | 2413780..2415189 | - | 1410 | WP_089519440.1 | PLP-dependent aminotransferase family protein | - |
EL145_RS11540 | 2415268..2415684 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EL145_RS11545 | 2415730..2415906 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EL145_RS11550 | 2416128..2416358 | + | 231 | WP_000494244.1 | YncJ family protein | - |
EL145_RS11555 | 2416450..2418411 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EL145_RS11560 | 2418484..2419020 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
EL145_RS11565 | 2419073..2420287 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2420327..2421475 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T287476 WP_000813794.1 NZ_LR134295:c2415906-2415730 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT287476 WP_001270286.1 NZ_LR134295:c2415684-2415268 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|