Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 352795..353492 | Replicon | chromosome |
Accession | NZ_LR134287 | ||
Organism | Neisseria animalis strain NCTC10212 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | EL111_RS01715 | Protein ID | WP_123795298.1 |
Coordinates | 352795..353091 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | EL111_RS01720 | Protein ID | WP_123795299.1 |
Coordinates | 353094..353492 (+) | Length | 133 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL111_RS01670 | 348278..349267 | + | 990 | WP_123795291.1 | NAD(P)-dependent glycerol-3-phosphate dehydrogenase | - |
EL111_RS01675 | 349369..349692 | + | 324 | WP_123795292.1 | hypothetical protein | - |
EL111_RS01680 | 349706..350005 | + | 300 | WP_123795293.1 | cell division protein ZapA | - |
EL111_RS01690 | 350326..351102 | + | 777 | WP_123795294.1 | triose-phosphate isomerase | - |
EL111_RS01695 | 351108..351455 | + | 348 | WP_123795295.1 | preprotein translocase subunit SecG | - |
EL111_RS01705 | 351914..352171 | + | 258 | WP_123795296.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EL111_RS01710 | 352171..352590 | + | 420 | WP_123795297.1 | type II toxin-antitoxin system VapC family toxin | - |
EL111_RS01715 | 352795..353091 | + | 297 | WP_123795298.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
EL111_RS01720 | 353094..353492 | + | 399 | WP_123795299.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EL111_RS01725 | 353638..353949 | + | 312 | WP_123795300.1 | DNA-binding transcriptional regulator | - |
EL111_RS01730 | 355041..356669 | + | 1629 | WP_123795301.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11091.95 Da Isoelectric Point: 9.7581
>T287456 WP_123795298.1 NZ_LR134287:352795-353091 [Neisseria animalis]
MEKRIPHTKLAKVKALLKSGKVRTTQTALIGAVQMGFDYDSMLAVVHNLTPADFYKSMTTHANHTIWQDVYRPDTDLGRV
YLKLTVIDDALIVSFKEL
MEKRIPHTKLAKVKALLKSGKVRTTQTALIGAVQMGFDYDSMLAVVHNLTPADFYKSMTTHANHTIWQDVYRPDTDLGRV
YLKLTVIDDALIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 133 a.a. Molecular weight: 14662.85 Da Isoelectric Point: 7.6302
>AT287456 WP_123795299.1 NZ_LR134287:353094-353492 [Neisseria animalis]
MKCPVCNQAELIRDTRDMPYTYKGQDTVIPAVTADYCPACNEVVTDEAESRRIMAAMQAFNKQINSATADPAYIQSVRKK
LQLDQRQAAEIFGGGVNAFSRYETGKATPPLALLQLFKILDKHPALLSEIRP
MKCPVCNQAELIRDTRDMPYTYKGQDTVIPAVTADYCPACNEVVTDEAESRRIMAAMQAFNKQINSATADPAYIQSVRKK
LQLDQRQAAEIFGGGVNAFSRYETGKATPPLALLQLFKILDKHPALLSEIRP
Download Length: 399 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|