Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4743812..4744587 | Replicon | chromosome |
| Accession | NZ_LR134280 | ||
| Organism | Klebsiella pneumoniae strain NCTC9793 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1W1JAQ8 |
| Locus tag | EL169_RS23785 | Protein ID | WP_009308645.1 |
| Coordinates | 4744102..4744587 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | EL169_RS23780 | Protein ID | WP_004150912.1 |
| Coordinates | 4743812..4744105 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL169_RS23760 | 4739020..4739622 | - | 603 | WP_032448122.1 | short chain dehydrogenase | - |
| EL169_RS23765 | 4739720..4740631 | + | 912 | WP_004181308.1 | LysR family transcriptional regulator | - |
| EL169_RS23770 | 4740632..4741780 | - | 1149 | WP_040236164.1 | PLP-dependent aspartate aminotransferase family protein | - |
| EL169_RS23775 | 4741791..4743167 | - | 1377 | WP_072269297.1 | cystathionine beta-synthase | - |
| EL169_RS23780 | 4743812..4744105 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| EL169_RS23785 | 4744102..4744587 | + | 486 | WP_009308645.1 | GNAT family N-acetyltransferase | Toxin |
| EL169_RS23790 | 4745291..4745884 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| EL169_RS23795 | 4745981..4746197 | + | 217 | Protein_4460 | transposase | - |
| EL169_RS23805 | 4746804..4747676 | + | 873 | WP_040236165.1 | ParA family protein | - |
| EL169_RS23810 | 4747676..4748059 | + | 384 | WP_040236166.1 | hypothetical protein | - |
| EL169_RS23815 | 4748052..4749419 | + | 1368 | WP_040236167.1 | replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 4745981..4746133 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17595.60 Da Isoelectric Point: 8.5144
>T287452 WP_009308645.1 NZ_LR134280:4744102-4744587 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1W1JAQ8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |