Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4360883..4361469 Replicon chromosome
Accession NZ_LR134280
Organism Klebsiella pneumoniae strain NCTC9793

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag EL169_RS21775 Protein ID WP_002920800.1
Coordinates 4361101..4361469 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag EL169_RS21770 Protein ID WP_004174006.1
Coordinates 4360883..4361104 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL169_RS21750 4357040..4357966 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EL169_RS21755 4357963..4359240 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
EL169_RS21760 4359237..4360004 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EL169_RS21765 4360006..4360719 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EL169_RS21770 4360883..4361104 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL169_RS21775 4361101..4361469 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL169_RS21780 4361742..4363058 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EL169_RS21785 4363165..4364052 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EL169_RS21790 4364049..4364894 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EL169_RS21795 4364896..4365966 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4357963..4366703 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T287451 WP_002920800.1 NZ_LR134280:4361101-4361469 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT287451 WP_004174006.1 NZ_LR134280:4360883-4361104 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References