Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2551618..2551802 | Replicon | chromosome |
| Accession | NZ_LR134271 | ||
| Organism | Staphylococcus aureus strain NCTC7988 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | EL099_RS13315 | Protein ID | WP_000482647.1 |
| Coordinates | 2551695..2551802 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2551618..2551678 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL099_RS13290 | 2547072..2547239 | - | 168 | WP_041204334.1 | hypothetical protein | - |
| EL099_RS13300 | 2547470..2549203 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
| EL099_RS13305 | 2549228..2550991 | - | 1764 | WP_001064817.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2551618..2551678 | + | 61 | - | - | Antitoxin |
| EL099_RS13315 | 2551695..2551802 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| EL099_RS13320 | 2551936..2552322 | - | 387 | WP_000779350.1 | flippase GtxA | - |
| EL099_RS13325 | 2552590..2553732 | + | 1143 | WP_001176868.1 | glycerate kinase | - |
| EL099_RS13330 | 2553792..2554451 | + | 660 | WP_000831299.1 | hypothetical protein | - |
| EL099_RS13335 | 2554637..2555848 | + | 1212 | WP_001191928.1 | multidrug effflux MFS transporter | - |
| EL099_RS13340 | 2555971..2556444 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T287437 WP_000482647.1 NZ_LR134271:c2551802-2551695 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT287437 NZ_LR134271:2551618-2551678 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|