Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2261314..2261577 | Replicon | chromosome |
Accession | NZ_LR134271 | ||
Organism | Staphylococcus aureus strain NCTC7988 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | EL099_RS11780 | Protein ID | WP_001802298.1 |
Coordinates | 2261473..2261577 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2261314..2261478 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL099_RS11760 | 2257488..2258153 | - | 666 | WP_001024100.1 | SDR family oxidoreductase | - |
EL099_RS11765 | 2258305..2258625 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
EL099_RS11770 | 2258627..2259607 | + | 981 | WP_000019740.1 | CDF family zinc efflux transporter CzrB | - |
EL099_RS11775 | 2259873..2260964 | + | 1092 | WP_000495692.1 | hypothetical protein | - |
- | 2261314..2261478 | + | 165 | - | - | Antitoxin |
EL099_RS11780 | 2261473..2261577 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
EL099_RS14855 | 2261738..2262221 | - | 484 | Protein_2183 | recombinase family protein | - |
EL099_RS11790 | 2262264..2263384 | - | 1121 | Protein_2184 | SAP domain-containing protein | - |
EL099_RS11795 | 2264433..2265290 | - | 858 | WP_000370943.1 | Cof-type HAD-IIB family hydrolase | - |
EL099_RS11800 | 2265358..2266140 | - | 783 | WP_070040383.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T287434 WP_001802298.1 NZ_LR134271:c2261577-2261473 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT287434 NZ_LR134271:2261314-2261478 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|