Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1897768..1897948 | Replicon | chromosome |
Accession | NZ_LR134271 | ||
Organism | Staphylococcus aureus strain NCTC7988 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EL099_RS09565 | Protein ID | WP_001801861.1 |
Coordinates | 1897768..1897863 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1897891..1897948 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL099_RS09530 | 1893172..1893798 | + | 627 | WP_000669034.1 | hypothetical protein | - |
EL099_RS09535 | 1893839..1894180 | + | 342 | WP_000627544.1 | DUF3969 family protein | - |
EL099_RS09540 | 1894281..1894853 | + | 573 | WP_000414210.1 | hypothetical protein | - |
EL099_RS09545 | 1895229..1896065 | + | 837 | WP_000190484.1 | ABC transporter ATP-binding protein | - |
EL099_RS09555 | 1896871..1897317 | - | 447 | WP_000747806.1 | DUF1433 domain-containing protein | - |
EL099_RS09565 | 1897768..1897863 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1897891..1897948 | - | 58 | - | - | Antitoxin |
EL099_RS09570 | 1897986..1898087 | + | 102 | WP_001791232.1 | hypothetical protein | - |
EL099_RS09575 | 1898073..1898252 | - | 180 | Protein_1803 | transposase | - |
EL099_RS09580 | 1898440..1898814 | - | 375 | WP_000695817.1 | DUF1433 domain-containing protein | - |
EL099_RS09585 | 1898804..1899184 | - | 381 | WP_070040298.1 | DUF1433 domain-containing protein | - |
EL099_RS09590 | 1899392..1899832 | - | 441 | WP_000759945.1 | DUF1433 domain-containing protein | - |
EL099_RS09595 | 1899877..1901490 | + | 1614 | WP_000926709.1 | hypothetical protein | - |
EL099_RS09600 | 1901505..1901804 | + | 300 | WP_000095391.1 | WXG100 family type VII secretion target | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / lukS-PV / lukS-PV | 1896053..1950958 | 54905 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T287430 WP_001801861.1 NZ_LR134271:1897768-1897863 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT287430 NZ_LR134271:c1897948-1897891 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|