Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1897768..1897948 Replicon chromosome
Accession NZ_LR134271
Organism Staphylococcus aureus strain NCTC7988

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag EL099_RS09565 Protein ID WP_001801861.1
Coordinates 1897768..1897863 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1897891..1897948 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL099_RS09530 1893172..1893798 + 627 WP_000669034.1 hypothetical protein -
EL099_RS09535 1893839..1894180 + 342 WP_000627544.1 DUF3969 family protein -
EL099_RS09540 1894281..1894853 + 573 WP_000414210.1 hypothetical protein -
EL099_RS09545 1895229..1896065 + 837 WP_000190484.1 ABC transporter ATP-binding protein -
EL099_RS09555 1896871..1897317 - 447 WP_000747806.1 DUF1433 domain-containing protein -
EL099_RS09565 1897768..1897863 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1897891..1897948 - 58 - - Antitoxin
EL099_RS09570 1897986..1898087 + 102 WP_001791232.1 hypothetical protein -
EL099_RS09575 1898073..1898252 - 180 Protein_1803 transposase -
EL099_RS09580 1898440..1898814 - 375 WP_000695817.1 DUF1433 domain-containing protein -
EL099_RS09585 1898804..1899184 - 381 WP_070040298.1 DUF1433 domain-containing protein -
EL099_RS09590 1899392..1899832 - 441 WP_000759945.1 DUF1433 domain-containing protein -
EL099_RS09595 1899877..1901490 + 1614 WP_000926709.1 hypothetical protein -
EL099_RS09600 1901505..1901804 + 300 WP_000095391.1 WXG100 family type VII secretion target -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / lukS-PV / lukS-PV 1896053..1950958 54905


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T287430 WP_001801861.1 NZ_LR134271:1897768-1897863 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT287430 NZ_LR134271:c1897948-1897891 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References