Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | holin-SprF3/- |
Location | 363890..364408 | Replicon | chromosome |
Accession | NZ_LR134271 | ||
Organism | Staphylococcus aureus strain NCTC7988 |
Toxin (Protein)
Gene name | holin | Uniprot ID | - |
Locus tag | EL099_RS01785 | Protein ID | WP_000448764.1 |
Coordinates | 364106..364408 (+) | Length | 101 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 363890..364026 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL099_RS01745 | 358984..359274 | + | 291 | WP_000179860.1 | hypothetical protein | - |
EL099_RS01750 | 359290..361200 | + | 1911 | WP_000429563.1 | hypothetical protein | - |
EL099_RS01755 | 361200..362666 | + | 1467 | WP_000067157.1 | BppU family phage baseplate upper protein | - |
EL099_RS01760 | 362666..363055 | + | 390 | WP_001166604.1 | DUF2977 domain-containing protein | - |
EL099_RS01765 | 363048..363212 | + | 165 | WP_000916020.1 | XkdX family protein | - |
EL099_RS01770 | 363258..363557 | + | 300 | WP_000466773.1 | DUF2951 family protein | - |
EL099_RS14880 | 363709..363898 | + | 190 | Protein_335 | putative holin-like toxin | - |
- | 363890..364026 | - | 137 | NuclAT_0 | - | Antitoxin |
- | 363890..364026 | - | 137 | NuclAT_0 | - | Antitoxin |
- | 363890..364026 | - | 137 | NuclAT_0 | - | Antitoxin |
- | 363890..364026 | - | 137 | NuclAT_0 | - | Antitoxin |
EL099_RS01780 | 363945..364055 | - | 111 | WP_070003492.1 | hypothetical protein | - |
EL099_RS01785 | 364106..364408 | + | 303 | WP_000448764.1 | phage holin | Toxin |
EL099_RS01790 | 364420..365874 | + | 1455 | WP_000930278.1 | N-acetylmuramoyl-L-alanine amidase | - |
EL099_RS01800 | 367388..367885 | + | 498 | WP_001803960.1 | hypothetical protein | - |
EL099_RS01810 | 368445..369272 | - | 828 | WP_000136028.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 320737..365874 | 45137 | |
- | inside | Prophage | - | geh | 316180..365874 | 49694 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11230.99 Da Isoelectric Point: 9.6587
>T287426 WP_000448764.1 NZ_LR134271:364106-364408 [Staphylococcus aureus]
METKVITRYIVLILALVNQFLANKGISPIPVDEESISSIILTVIALYTAYKDNPTSQEGRWANQKLKKYKAENKYRKATG
QAPIKEVMTPTNMNDTNDLG
METKVITRYIVLILALVNQFLANKGISPIPVDEESISSIILTVIALYTAYKDNPTSQEGRWANQKLKKYKAENKYRKATG
QAPIKEVMTPTNMNDTNDLG
Download Length: 303 bp
Antitoxin
Download Length: 137 bp
>AT287426 NZ_LR134271:c364026-363890 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGACCTCTGTAGTTAAAT
GAATTTATATAATCCTCTAACCATCGTACTCGTCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGACCTCTGTAGTTAAAT
GAATTTATATAATCCTCTAACCATCGTACTCGTCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|