Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2582346..2582571 Replicon chromosome
Accession NZ_LR134270
Organism Escherichia marmotae strain NCTC8196

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag EL146_RS12665 Protein ID WP_000813254.1
Coordinates 2582346..2582501 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2582513..2582571 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL146_RS12625 2577626..2577841 - 216 WP_000839596.1 phage lysis protein EssD -
EL146_RS12640 2578860..2580068 - 1209 WP_000343717.1 IS256 family transposase -
EL146_RS12645 2580457..2580993 - 537 WP_000640127.1 DUF1133 family protein -
EL146_RS12650 2580990..2581280 - 291 WP_000228021.1 DUF1364 domain-containing protein -
EL146_RS12655 2581280..2581879 - 600 WP_000940322.1 DUF1367 family protein -
EL146_RS12665 2582346..2582501 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2582513..2582571 + 59 - - Antitoxin
EL146_RS12675 2582739..2583404 - 666 WP_021554705.1 epoxyqueuosine reductase QueH -
EL146_RS12680 2583589..2584005 - 417 WP_001151236.1 DUF977 family protein -
EL146_RS12685 2584021..2584782 - 762 WP_000450696.1 DUF1627 domain-containing protein -
EL146_RS12690 2584805..2585551 - 747 WP_000788766.1 ATP-binding protein -
EL146_RS12695 2585558..2586415 - 858 WP_000899759.1 DUF1376 domain-containing protein -
EL146_RS12700 2586428..2586850 - 423 WP_000693802.1 hypothetical protein -
EL146_RS12705 2586847..2587101 - 255 WP_001072342.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2550176..2596066 45890
- flank IS/Tn - - 2578860..2580068 1208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T287423 WP_000813254.1 NZ_LR134270:c2582501-2582346 [Escherichia marmotae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT287423 NZ_LR134270:2582513-2582571 [Escherichia marmotae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References