Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 802472..802730 | Replicon | chromosome |
| Accession | NZ_LR134270 | ||
| Organism | Escherichia marmotae strain NCTC8196 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | EL146_RS03915 | Protein ID | WP_000809168.1 |
| Coordinates | 802472..802624 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 802673..802730 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL146_RS03890 | 797797..798363 | - | 567 | WP_000528538.1 | acetate uptake transporter | - |
| EL146_RS03900 | 798646..798855 | - | 210 | WP_000843573.1 | DUF2541 family protein | - |
| EL146_RS03905 | 799232..801148 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| EL146_RS03910 | 801237..802367 | + | 1131 | WP_001118463.1 | molecular chaperone DnaJ | - |
| EL146_RS03915 | 802472..802624 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 802673..802730 | + | 58 | - | - | Antitoxin |
| EL146_RS03920 | 803208..804374 | + | 1167 | WP_000681378.1 | Na+/H+ antiporter NhaA | - |
| EL146_RS03925 | 804434..805339 | + | 906 | WP_000062876.1 | transcriptional activator NhaR | - |
| EL146_RS03930 | 805442..805705 | - | 264 | WP_001274018.1 | 30S ribosomal protein S20 | - |
| EL146_RS03935 | 805808..806026 | + | 219 | Protein_743 | DUF2575 domain-containing protein | - |
| EL146_RS03940 | 806034..806975 | + | 942 | WP_000767344.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T287414 WP_000809168.1 NZ_LR134270:c802624-802472 [Escherichia marmotae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT287414 NZ_LR134270:802673-802730 [Escherichia marmotae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|