Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 960807..960968 | Replicon | chromosome |
Accession | NZ_LR134269 | ||
Organism | Staphylococcus warneri strain NCTC11044 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | EL082_RS04785 | Protein ID | WP_126474883.1 |
Coordinates | 960807..960902 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 960934..960968 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL082_RS04775 | 956778..959711 | + | 2934 | WP_103286322.1 | AAA family ATPase | - |
EL082_RS04780 | 959711..960652 | + | 942 | WP_002466800.1 | 3'-5' exoribonuclease YhaM | - |
EL082_RS04785 | 960807..960902 | + | 96 | WP_126474883.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 960934..960968 | - | 35 | - | - | Antitoxin |
EL082_RS04790 | 961054..962046 | - | 993 | WP_002466825.1 | peptidylprolyl isomerase | - |
EL082_RS04795 | 962224..962781 | - | 558 | WP_002466819.1 | DUF3267 domain-containing protein | - |
EL082_RS04800 | 962976..963347 | - | 372 | WP_002452114.1 | YtxH domain-containing protein | - |
EL082_RS04805 | 963425..963850 | - | 426 | WP_002466803.1 | HIT family protein | - |
EL082_RS04810 | 963982..964722 | + | 741 | WP_002466806.1 | ABC transporter ATP-binding protein | - |
EL082_RS04815 | 964715..965938 | + | 1224 | WP_049416178.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3601.25 Da Isoelectric Point: 8.0615
>T287409 WP_126474883.1 NZ_LR134269:960807-960902 [Staphylococcus warneri]
MTEIFVHIATTVISGCIVTLFAQWLRHRNDK
MTEIFVHIATTVISGCIVTLFAQWLRHRNDK
Download Length: 96 bp
Antitoxin
Download Length: 35 bp
>AT287409 NZ_LR134269:c960968-960934 [Staphylococcus warneri]
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|