Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3561062..3561756 Replicon chromosome
Accession NZ_LR134248
Organism Escherichia coli strain NCTC10537

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag EL141_RS17410 Protein ID WP_001263493.1
Coordinates 3561062..3561460 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag EL141_RS17415 Protein ID WP_000554757.1
Coordinates 3561463..3561756 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL141_RS17380 3556062..3557306 - 1245 WP_000189541.1 esterase FrsA -
- 3556722..3556802 - 81 NuclAT_13 - -
- 3556722..3556802 - 81 NuclAT_13 - -
- 3556722..3556802 - 81 NuclAT_13 - -
- 3556722..3556802 - 81 NuclAT_13 - -
EL141_RS17385 3557398..3557856 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL141_RS17390 3558117..3559574 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
EL141_RS17395 3559631..3560152 - 522 Protein_3381 peptide chain release factor H -
EL141_RS17400 3560151..3560354 - 204 Protein_3382 RNA ligase RtcB family protein -
EL141_RS17405 3560600..3561052 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
EL141_RS17410 3561062..3561460 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL141_RS17415 3561463..3561756 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL141_RS17420 3561808..3562863 - 1056 WP_001226164.1 DNA polymerase IV -
EL141_RS17425 3562934..3563719 - 786 WP_000207564.1 putative lateral flagellar export/assembly protein LafU -
EL141_RS17430 3563691..3565403 + 1713 Protein_3388 flagellar biosynthesis protein FlhA -
EL141_RS17435 3565619..3566116 - 498 WP_000006260.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T287390 WP_001263493.1 NZ_LR134248:c3561460-3561062 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT287390 WP_000554757.1 NZ_LR134248:c3561756-3561463 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References