Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3561062..3561756 | Replicon | chromosome |
| Accession | NZ_LR134248 | ||
| Organism | Escherichia coli strain NCTC10537 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | EL141_RS17410 | Protein ID | WP_001263493.1 |
| Coordinates | 3561062..3561460 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | EL141_RS17415 | Protein ID | WP_000554757.1 |
| Coordinates | 3561463..3561756 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL141_RS17380 | 3556062..3557306 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3556722..3556802 | - | 81 | NuclAT_13 | - | - |
| - | 3556722..3556802 | - | 81 | NuclAT_13 | - | - |
| - | 3556722..3556802 | - | 81 | NuclAT_13 | - | - |
| - | 3556722..3556802 | - | 81 | NuclAT_13 | - | - |
| EL141_RS17385 | 3557398..3557856 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| EL141_RS17390 | 3558117..3559574 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| EL141_RS17395 | 3559631..3560152 | - | 522 | Protein_3381 | peptide chain release factor H | - |
| EL141_RS17400 | 3560151..3560354 | - | 204 | Protein_3382 | RNA ligase RtcB family protein | - |
| EL141_RS17405 | 3560600..3561052 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| EL141_RS17410 | 3561062..3561460 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| EL141_RS17415 | 3561463..3561756 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| EL141_RS17420 | 3561808..3562863 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| EL141_RS17425 | 3562934..3563719 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| EL141_RS17430 | 3563691..3565403 | + | 1713 | Protein_3388 | flagellar biosynthesis protein FlhA | - |
| EL141_RS17435 | 3565619..3566116 | - | 498 | WP_000006260.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T287390 WP_001263493.1 NZ_LR134248:c3561460-3561062 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|