Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3931172..3931866 Replicon chromosome
Accession NZ_LR134247
Organism Escherichia coli strain NCTC9040

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag EL149_RS19830 Protein ID WP_001263489.1
Coordinates 3931172..3931570 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag EL149_RS19835 Protein ID WP_000554758.1
Coordinates 3931573..3931866 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- 3926761..3926841 - 81 NuclAT_11 - -
- 3926761..3926841 - 81 NuclAT_11 - -
- 3926761..3926841 - 81 NuclAT_11 - -
- 3926761..3926841 - 81 NuclAT_11 - -
EL149_RS19805 3927436..3927894 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL149_RS19810 3928155..3929612 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
EL149_RS19815 3929669..3930190 - 522 Protein_3828 peptide chain release factor H -
EL149_RS19820 3930186..3930392 - 207 Protein_3829 RtcB family protein -
EL149_RS19825 3930710..3931162 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
EL149_RS19830 3931172..3931570 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL149_RS19835 3931573..3931866 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL149_RS19840 3931918..3932973 - 1056 WP_001226164.1 DNA polymerase IV -
EL149_RS19845 3933044..3933967 - 924 WP_001232546.1 putative lateral flagellar export/assembly protein LafU -
EL149_RS19850 3933970..3934833 - 864 WP_001169518.1 flagellar motor stator protein MotA -
EL149_RS19855 3934846..3935562 - 717 WP_000938723.1 FliA/WhiG family RNA polymerase sigma factor -
EL149_RS19860 3935582..3936049 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3860192..3932973 72781


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T287374 WP_001263489.1 NZ_LR134247:c3931570-3931172 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT287374 WP_000554758.1 NZ_LR134247:c3931866-3931573 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References