Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 752758..753451 | Replicon | chromosome |
Accession | NZ_LR134247 | ||
Organism | Escherichia coli strain NCTC9040 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | EL149_RS03705 | Protein ID | WP_000415584.1 |
Coordinates | 752758..753054 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | EL149_RS03710 | Protein ID | WP_000650107.1 |
Coordinates | 753056..753451 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL149_RS03670 | 747846..748160 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
EL149_RS03675 | 748191..748772 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
EL149_RS03680 | 749091..749423 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
EL149_RS03685 | 749469..750818 | - | 1350 | WP_000673402.1 | two-component system sensor histidine kinase QseC | - |
EL149_RS03690 | 750815..751474 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
EL149_RS03695 | 751626..752018 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
EL149_RS03700 | 752071..752553 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
EL149_RS03705 | 752758..753054 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
EL149_RS03710 | 753056..753451 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
EL149_RS03715 | 753584..755191 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
EL149_RS03720 | 755329..757587 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T287358 WP_000415584.1 NZ_LR134247:752758-753054 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT287358 WP_000650107.1 NZ_LR134247:753056-753451 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|