Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 972497..972658 | Replicon | chromosome |
| Accession | NZ_LR134244 | ||
| Organism | Staphylococcus warneri strain NCTC7291 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | EL075_RS04805 | Protein ID | WP_015364873.1 |
| Coordinates | 972497..972592 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 972624..972658 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL075_RS04795 | 968468..971401 | + | 2934 | WP_126403146.1 | AAA family ATPase | - |
| EL075_RS04800 | 971401..972342 | + | 942 | WP_002466800.1 | 3'-5' exoribonuclease YhaM | - |
| EL075_RS04805 | 972497..972592 | + | 96 | WP_015364873.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 972624..972658 | - | 35 | - | - | Antitoxin |
| EL075_RS04810 | 972744..973736 | - | 993 | WP_126403147.1 | peptidylprolyl isomerase | - |
| EL075_RS04815 | 973914..974471 | - | 558 | WP_002466819.1 | DUF3267 domain-containing protein | - |
| EL075_RS04820 | 974666..975037 | - | 372 | WP_002452114.1 | YtxH domain-containing protein | - |
| EL075_RS04825 | 975115..975540 | - | 426 | WP_002466803.1 | HIT family protein | - |
| EL075_RS04830 | 975672..976412 | + | 741 | WP_002466806.1 | ABC transporter ATP-binding protein | - |
| EL075_RS04835 | 976405..977628 | + | 1224 | WP_002466814.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3610.26 Da Isoelectric Point: 8.0878
>T287354 WP_015364873.1 NZ_LR134244:972497-972592 [Staphylococcus warneri]
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
Download Length: 96 bp
Antitoxin
Download Length: 35 bp
>AT287354 NZ_LR134244:c972658-972624 [Staphylococcus warneri]
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|