Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 1013315..1013476 | Replicon | chromosome |
Accession | NZ_LR134242 | ||
Organism | Staphylococcus warneri strain NCTC4133 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | EL068_RS05020 | Protein ID | WP_015364873.1 |
Coordinates | 1013315..1013410 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1013442..1013476 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL068_RS05010 | 1009286..1012219 | + | 2934 | WP_126510295.1 | AAA family ATPase | - |
EL068_RS05015 | 1012219..1013160 | + | 942 | WP_002466800.1 | 3'-5' exoribonuclease YhaM | - |
EL068_RS05020 | 1013315..1013410 | + | 96 | WP_015364873.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1013442..1013476 | - | 35 | - | - | Antitoxin |
EL068_RS05025 | 1013562..1014554 | - | 993 | WP_002466825.1 | peptidylprolyl isomerase | - |
EL068_RS05030 | 1014732..1015289 | - | 558 | WP_002466819.1 | DUF3267 domain-containing protein | - |
EL068_RS05035 | 1015484..1015855 | - | 372 | WP_002452114.1 | YtxH domain-containing protein | - |
EL068_RS05040 | 1015933..1016358 | - | 426 | WP_058710124.1 | HIT family protein | - |
EL068_RS05045 | 1016490..1017230 | + | 741 | WP_002466806.1 | ABC transporter ATP-binding protein | - |
EL068_RS05050 | 1017223..1018446 | + | 1224 | WP_126510296.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3610.26 Da Isoelectric Point: 8.0878
>T287347 WP_015364873.1 NZ_LR134242:1013315-1013410 [Staphylococcus warneri]
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
Download Length: 96 bp
Antitoxin
Download Length: 35 bp
>AT287347 NZ_LR134242:c1013476-1013442 [Staphylococcus warneri]
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|