Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3715523..3716217 Replicon chromosome
Accession NZ_LR134240
Organism Escherichia coli strain NCTC9107

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag EL129_RS18260 Protein ID WP_001263493.1
Coordinates 3715523..3715921 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag EL129_RS18265 Protein ID WP_000554757.1
Coordinates 3715924..3716217 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL129_RS18230 3710523..3711767 - 1245 WP_000189541.1 esterase FrsA -
- 3711183..3711263 - 81 NuclAT_10 - -
- 3711183..3711263 - 81 NuclAT_10 - -
- 3711183..3711263 - 81 NuclAT_10 - -
- 3711183..3711263 - 81 NuclAT_10 - -
EL129_RS18235 3711859..3712317 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL129_RS18240 3712578..3714035 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
EL129_RS18245 3714092..3714613 - 522 Protein_3530 peptide chain release factor H -
EL129_RS18250 3714612..3714815 - 204 Protein_3531 RNA ligase RtcB family protein -
EL129_RS18255 3715061..3715513 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
EL129_RS18260 3715523..3715921 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL129_RS18265 3715924..3716217 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL129_RS18270 3716269..3717324 - 1056 WP_001226164.1 DNA polymerase IV -
EL129_RS18275 3717395..3718180 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
EL129_RS18280 3718152..3719864 + 1713 Protein_3537 flagellar biosynthesis protein FlhA -
EL129_RS18285 3720088..3720585 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 3714561..3730804 16243


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T287338 WP_001263493.1 NZ_LR134240:c3715921-3715523 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT287338 WP_000554757.1 NZ_LR134240:c3716217-3715924 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References