Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3715523..3716217 | Replicon | chromosome |
| Accession | NZ_LR134240 | ||
| Organism | Escherichia coli strain NCTC9107 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | EL129_RS18260 | Protein ID | WP_001263493.1 |
| Coordinates | 3715523..3715921 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | EL129_RS18265 | Protein ID | WP_000554757.1 |
| Coordinates | 3715924..3716217 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL129_RS18230 | 3710523..3711767 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3711183..3711263 | - | 81 | NuclAT_10 | - | - |
| - | 3711183..3711263 | - | 81 | NuclAT_10 | - | - |
| - | 3711183..3711263 | - | 81 | NuclAT_10 | - | - |
| - | 3711183..3711263 | - | 81 | NuclAT_10 | - | - |
| EL129_RS18235 | 3711859..3712317 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| EL129_RS18240 | 3712578..3714035 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| EL129_RS18245 | 3714092..3714613 | - | 522 | Protein_3530 | peptide chain release factor H | - |
| EL129_RS18250 | 3714612..3714815 | - | 204 | Protein_3531 | RNA ligase RtcB family protein | - |
| EL129_RS18255 | 3715061..3715513 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| EL129_RS18260 | 3715523..3715921 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| EL129_RS18265 | 3715924..3716217 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| EL129_RS18270 | 3716269..3717324 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| EL129_RS18275 | 3717395..3718180 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| EL129_RS18280 | 3718152..3719864 | + | 1713 | Protein_3537 | flagellar biosynthesis protein FlhA | - |
| EL129_RS18285 | 3720088..3720585 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3714561..3730804 | 16243 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T287338 WP_001263493.1 NZ_LR134240:c3715921-3715523 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|