Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3514440..3515152 | Replicon | chromosome |
| Accession | NZ_LR134239 | ||
| Organism | Escherichia coli strain NCTC9100 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | EL124_RS17150 | Protein ID | WP_126510788.1 |
| Coordinates | 3514440..3514856 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | EL124_RS17155 | Protein ID | WP_000554758.1 |
| Coordinates | 3514859..3515152 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - | 3510045..3510125 | - | 81 | NuclAT_11 | - | - |
| - | 3510045..3510125 | - | 81 | NuclAT_11 | - | - |
| - | 3510045..3510125 | - | 81 | NuclAT_11 | - | - |
| - | 3510045..3510125 | - | 81 | NuclAT_11 | - | - |
| EL124_RS17125 | 3510721..3511179 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| EL124_RS17130 | 3511440..3512897 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| EL124_RS17135 | 3512954..3513475 | - | 522 | Protein_3334 | peptide chain release factor H | - |
| EL124_RS17140 | 3513471..3513677 | - | 207 | Protein_3335 | RtcB family protein | - |
| EL124_RS17145 | 3513995..3514447 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| EL124_RS17150 | 3514440..3514856 | - | 417 | WP_126510788.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| EL124_RS17155 | 3514859..3515152 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| EL124_RS17160 | 3515204..3516260 | - | 1057 | Protein_3339 | DNA polymerase IV | - |
| EL124_RS17165 | 3516331..3517116 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| EL124_RS17170 | 3517088..3518800 | + | 1713 | Protein_3341 | flagellar biosynthesis protein FlhA | - |
| EL124_RS17175 | 3519024..3519521 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16283.73 Da Isoelectric Point: 6.9792
>T287319 WP_126510788.1 NZ_LR134239:c3514856-3514440 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRFLNLYYE
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRFLNLYYE
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|