Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 709436..710129 | Replicon | chromosome |
Accession | NZ_LR134239 | ||
Organism | Escherichia coli strain NCTC9100 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | EL124_RS03435 | Protein ID | WP_000415584.1 |
Coordinates | 709436..709732 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | EL124_RS03440 | Protein ID | WP_000650107.1 |
Coordinates | 709734..710129 (+) | Length | 132 a.a. |
Genomic Context
Location: 705769..706101 (333 bp)
Type: Others
Protein ID: WP_000917684.1
Type: Others
Protein ID: WP_000917684.1
Location: 708304..708696 (393 bp)
Type: Others
Protein ID: WP_000712658.1
Type: Others
Protein ID: WP_000712658.1
Location: 708749..709231 (483 bp)
Type: Others
Protein ID: WP_000183505.1
Type: Others
Protein ID: WP_000183505.1
Location: 709436..709732 (297 bp)
Type: Toxin
Protein ID: WP_000415584.1
Type: Toxin
Protein ID: WP_000415584.1
Location: 709734..710129 (396 bp)
Type: Antitoxin
Protein ID: WP_000650107.1
Type: Antitoxin
Protein ID: WP_000650107.1
Location: 710262..711869 (1608 bp)
Type: Others
Protein ID: WP_001295629.1
Type: Others
Protein ID: WP_001295629.1
Location: 712007..714265 (2259 bp)
Type: Others
Protein ID: WP_001281881.1
Type: Others
Protein ID: WP_001281881.1
Location: 704524..704838 (315 bp)
Type: Others
Protein ID: WP_000958598.1
Type: Others
Protein ID: WP_000958598.1
Location: 704869..705450 (582 bp)
Type: Others
Protein ID: WP_000065430.1
Type: Others
Protein ID: WP_000065430.1
Location: 706147..707496 (1350 bp)
Type: Others
Protein ID: WP_000673402.1
Type: Others
Protein ID: WP_000673402.1
Location: 707493..708152 (660 bp)
Type: Others
Protein ID: WP_001221493.1
Type: Others
Protein ID: WP_001221493.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL124_RS03400 | 704524..704838 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
EL124_RS03405 | 704869..705450 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
EL124_RS03410 | 705769..706101 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
EL124_RS03415 | 706147..707496 | - | 1350 | WP_000673402.1 | two-component system sensor histidine kinase QseC | - |
EL124_RS03420 | 707493..708152 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
EL124_RS03425 | 708304..708696 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
EL124_RS03430 | 708749..709231 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
EL124_RS03435 | 709436..709732 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
EL124_RS03440 | 709734..710129 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
EL124_RS03445 | 710262..711869 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
EL124_RS03450 | 712007..714265 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T287308 WP_000415584.1 NZ_LR134239:709436-709732 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT287308 WP_000650107.1 NZ_LR134239:709734-710129 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp